Lineage for d1r9fa1 (1r9f A:27-148)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008959Fold d.255: Tombusvirus P19 core protein, VP19 [103144] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel sheet: order 2134
  4. 3008960Superfamily d.255.1: Tombusvirus P19 core protein, VP19 [103145] (1 family) (S)
  5. 3008961Family d.255.1.1: Tombusvirus P19 core protein, VP19 [103146] (2 proteins)
  6. 3008962Protein Tombusvirus P19 core protein, VP19 [103147] (2 species)
    an RNA silencing suppressor
  7. 3008966Species Tomato bushy stunt virus, TBSV [TaxId:12145] [103148] (1 PDB entry)
  8. 3008967Domain d1r9fa1: 1r9f A:27-148 [97257]
    Other proteins in same PDB: d1r9fa2
    complexed with siRNA
    protein/RNA complex; complexed with so4

Details for d1r9fa1

PDB Entry: 1r9f (more details), 1.85 Å

PDB Description: crystal structure of p19 complexed with 19-bp small interfering rna
PDB Compounds: (A:) Core protein P19

SCOPe Domain Sequences for d1r9fa1:

Sequence, based on SEQRES records: (download)

>d1r9fa1 d.255.1.1 (A:27-148) Tombusvirus P19 core protein, VP19 {Tomato bushy stunt virus, TBSV [TaxId: 12145]}
tspfklpdespswtewrlhndetnsnqdnplgfkeswgfgkvvfkrylrydrteaslhrv
lgswtgdsvnyaasrffgfdqigctysirfrgvsitvsggsrtlqhlcemairskqemlq
ma

Sequence, based on observed residues (ATOM records): (download)

>d1r9fa1 d.255.1.1 (A:27-148) Tombusvirus P19 core protein, VP19 {Tomato bushy stunt virus, TBSV [TaxId: 12145]}
tspfklpdespswtewrlhndetqdnplgfkeswgfgkvvfkrylrydrteaslhrvlgs
wtgdsvnyaasrffgfdqigctysirfrgvsitvsggsrtlqhlcemairskqemlqma

SCOPe Domain Coordinates for d1r9fa1:

Click to download the PDB-style file with coordinates for d1r9fa1.
(The format of our PDB-style files is described here.)

Timeline for d1r9fa1: