Lineage for d1r9cb_ (1r9c B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186669Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186670Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2186724Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2186770Protein Fosfomycin resistance protein FosX [102872] (1 species)
  7. 2186771Species Mesorhizobium loti [TaxId:381] [102873] (1 PDB entry)
  8. 2186773Domain d1r9cb_: 1r9c B: [97256]
    complexed with mn

Details for d1r9cb_

PDB Entry: 1r9c (more details), 1.83 Å

PDB Description: Crystal Structure of Fosfomycin Resistance Protein FosX from Mesorhizobium Loti
PDB Compounds: (B:) glutathione transferase

SCOPe Domain Sequences for d1r9cb_:

Sequence, based on SEQRES records: (download)

>d1r9cb_ d.32.1.2 (B:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]}
mieglshmtfivrdlermtrilegvfdarevyasdteqfslsrekffligdiwvaimqge
klaersynhiafkiddadfdryaervgklgldmrpprprvegegrsiyfydddnhmfelh
tgtlterla

Sequence, based on observed residues (ATOM records): (download)

>d1r9cb_ d.32.1.2 (B:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]}
mieglshmtfivrdlermtrilegvfdarevyasrekffligdiwvaimqgeklaersyn
hiafkiddadfdryaervgklgldmrpprpregrsiyfydddnhmfelhtgtlterla

SCOPe Domain Coordinates for d1r9cb_:

Click to download the PDB-style file with coordinates for d1r9cb_.
(The format of our PDB-style files is described here.)

Timeline for d1r9cb_: