SCOPe 2.05: Domain d1r9cb_: 1r9c B:

Lineage for d1r9cb_ (1r9c B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Fosfomycin resistance protein FosX [102872] (1 species)

7. Species Mesorhizobium loti [TaxId:381] [102873] (1 PDB entry)

8. Domain d1r9cb_: 1r9c B: [97256]
   complexed with mn

Details for d1r9cb_

PDB Entry: 1r9c, 1.83 Å

PDB Description: Crystal Structure of Fosfomycin Resistance Protein FosX from Mesorhizobium Loti

PDB Compounds: (B:) glutathione transferase

SCOPe Domain Sequences for d1r9cb_:

Sequence, based on SEQRES records:

>d1r9cb_ d.32.1.2 (B:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]}
mieglshmtfivrdlermtrilegvfdarevyasdteqfslsrekffligdiwvaimqge
klaersynhiafkiddadfdryaervgklgldmrpprprvegegrsiyfydddnhmfelh
tgtlterla

Sequence, based on observed residues (ATOM records):

>d1r9cb_ d.32.1.2 (B:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]}
mieglshmtfivrdlermtrilegvfdarevyasrekffligdiwvaimqgeklaersyn
hiafkiddadfdryaervgklgldmrpprpregrsiyfydddnhmfelhtgtlterla

Timeline for d1r9cb_:

• d1r9cb_ first appeared in SCOP 1.67
  
• d1r9cb_ appears in SCOPe 2.04
  
• d1r9cb_ appears in SCOPe 2.06
  
• d1r9cb_ appears in the current release, SCOPe 2.08