Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein Fosfomycin resistance protein FosX [102872] (1 species) |
Species Mesorhizobium loti [TaxId:381] [102873] (1 PDB entry) |
Domain d1r9cb_: 1r9c B: [97256] complexed with mn |
PDB Entry: 1r9c (more details), 1.83 Å
SCOPe Domain Sequences for d1r9cb_:
Sequence, based on SEQRES records: (download)
>d1r9cb_ d.32.1.2 (B:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} mieglshmtfivrdlermtrilegvfdarevyasdteqfslsrekffligdiwvaimqge klaersynhiafkiddadfdryaervgklgldmrpprprvegegrsiyfydddnhmfelh tgtlterla
>d1r9cb_ d.32.1.2 (B:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} mieglshmtfivrdlermtrilegvfdarevyasrekffligdiwvaimqgeklaersyn hiafkiddadfdryaervgklgldmrpprpregrsiyfydddnhmfelhtgtlterla
Timeline for d1r9cb_: