SCOP 1.67: Domain d1r95b_: 1r95 B:

Lineage for d1r95b_ (1r95 B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.124: HesB-like domain [89359] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.124.1: HesB-like domain [89360] (1 family)

5. Family b.124.1.1: HesB-like domain [89361] (2 proteins)
   Pfam 01521; Iron-sulfur cluster scaffold domain

6. Protein Fe-S scaffold protein IscA (YfhF) [101849] (1 species)

7. Species Escherichia coli [TaxId:562] [101850] (2 PDB entries)

8. Domain d1r95b_: 1r95 B: [97254]

Details for d1r95b_

PDB Entry: 1r95, 2.65 Å

PDB Description: crystal structure of isca (native)

SCOP Domain Sequences for d1r95b_:

Sequence; same for both SEQRES and ATOM records:

>d1r95b_ b.124.1.1 (B:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli}
msitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgv
kvvvdgkslqfldgtqldfvkeglnegfkftnpnvkd

Timeline for d1r95b_:

• d1r95b_ is new in SCOP 1.67
  
• d1r95b_ appears in SCOP 1.69
  
• d1r95b_ appears in the current release, SCOPe 2.08