Lineage for d1r95a_ (1r95 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383388Fold b.124: HesB-like domain [89359] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 383389Superfamily b.124.1: HesB-like domain [89360] (1 family) (S)
  5. 383390Family b.124.1.1: HesB-like domain [89361] (2 proteins)
    Pfam 01521; Iron-sulfur cluster scaffold domain
  6. 383391Protein Fe-S scaffold protein IscA (YfhF) [101849] (1 species)
  7. 383392Species Escherichia coli [TaxId:562] [101850] (2 PDB entries)
  8. 383395Domain d1r95a_: 1r95 A: [97253]

Details for d1r95a_

PDB Entry: 1r95 (more details), 2.65 Å

PDB Description: crystal structure of isca (native)

SCOP Domain Sequences for d1r95a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r95a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli}
msitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgv
kvvvdgkslqfldgtqldfvkeglnegfkftnpnvkd

SCOP Domain Coordinates for d1r95a_:

Click to download the PDB-style file with coordinates for d1r95a_.
(The format of our PDB-style files is described here.)

Timeline for d1r95a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r95b_