Lineage for d1r94a_ (1r94 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383388Fold b.124: HesB-like domain [89359] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 383389Superfamily b.124.1: HesB-like domain [89360] (1 family) (S)
  5. 383390Family b.124.1.1: HesB-like domain [89361] (2 proteins)
    Pfam 01521; Iron-sulfur cluster scaffold domain
  6. 383391Protein Fe-S scaffold protein IscA (YfhF) [101849] (1 species)
  7. 383392Species Escherichia coli [TaxId:562] [101850] (2 PDB entries)
  8. 383393Domain d1r94a_: 1r94 A: [97251]

Details for d1r94a_

PDB Entry: 1r94 (more details), 2.3 Å

PDB Description: crystal structure of isca (mercury derivative)

SCOP Domain Sequences for d1r94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r94a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli}
msitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgv
kvvvdgkslqfldgtqldfvkeglnegfkftnpnvkd

SCOP Domain Coordinates for d1r94a_:

Click to download the PDB-style file with coordinates for d1r94a_.
(The format of our PDB-style files is described here.)

Timeline for d1r94a_: