SCOP 1.69: Domain d1r8ua_: 1r8u A:

Lineage for d1r8ua_ (1r8u A:)

1. Root: SCOP 1.69

2. Class j: Peptides [58231] (116 folds)

3. Fold j.96: Transactivation domain [81275] (1 superfamily)

4. Superfamily j.96.1: Transactivation domain [74800] (1 family)

5. Family j.96.1.1: Transactivation domain [74801] (2 proteins)

6. Protein Cbp/p300-interacting transactivator 2, Cited2 [90295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90296] (2 PDB entries)

8. Domain d1r8ua_: 1r8u A: [97249]
   Other proteins in same PDB: d1r8ub_
   complexed with TAZ1 domain of mouse CBP

Details for d1r8ua_

PDB Entry: 1r8u

PDB Description: nmr structure of cbp taz1/cited2 complex

SCOP Domain Sequences for d1r8ua_:

Sequence; same for both SEQRES and ATOM records:

>d1r8ua_ j.96.1.1 (A:) Cbp/p300-interacting transactivator 2, Cited2 {Human (Homo sapiens)}
tdfideevlmslviemgldrikelpelwlgqnefdfmtdfvckqqpsrvs

Timeline for d1r8ua_:

• d1r8ua_ first appeared in SCOP 1.67
  
• d1r8ua_ appears in SCOP 1.71
  
• d1r8ua_ appears in the current release, SCOPe 2.08