SCOPe 2.06: Domain d1r8se_: 1r8s E:

Lineage for d1r8se_ (1r8s E:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (2 families)

5. Family a.118.3.1: Sec7 domain [48426] (6 proteins)
   Pfam PF01369

6. Protein Exchange factor ARNO [48427] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48428] (6 PDB entries)

8. Domain d1r8se_: 1r8s E: [97248]
   Other proteins in same PDB: d1r8sa_
   complexed with bme, fmt, gdp, so3, so4; mutant

Details for d1r8se_

PDB Entry: 1r8s, 1.46 Å

PDB Description: arf1[delta1-17]-gdp in complex with a sec7 domain carrying the mutation of the catalytic glutamate to lysine

PDB Compounds: (E:) arno

SCOPe Domain Sequences for d1r8se_:

Sequence; same for both SEQRES and ATOM records:

>d1r8se_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens) [TaxId: 9606]}
nrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylgereel
nlavlhafvdlheftdlnlvqalrqflwsfrlpgkaqkidrmmeafaqryclcnpgvfqs
tdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlydsirne
pfkiped

Timeline for d1r8se_:

• d1r8se_ first appeared in SCOP 1.67
  
• d1r8se_ appears in SCOPe 2.05
  
• d1r8se_ appears in SCOPe 2.07
  
• d1r8se_ appears in the current release, SCOPe 2.08