![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.3: Sec7 domain [48425] (2 families) ![]() |
![]() | Family a.118.3.1: Sec7 domain [48426] (6 proteins) Pfam PF01369 |
![]() | Protein Exchange factor ARNO [48427] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48428] (5 PDB entries) |
![]() | Domain d1r8se_: 1r8s E: [97248] Other proteins in same PDB: d1r8sa_ complexed with bme, fmt, gdp, so3, so4; mutant |
PDB Entry: 1r8s (more details), 1.46 Å
SCOPe Domain Sequences for d1r8se_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8se_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens) [TaxId: 9606]} nrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylgereel nlavlhafvdlheftdlnlvqalrqflwsfrlpgkaqkidrmmeafaqryclcnpgvfqs tdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlydsirne pfkiped
Timeline for d1r8se_: