Lineage for d1r8se_ (1r8s E:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447406Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 447606Superfamily a.118.3: Sec7 domain [48425] (1 family) (S)
  5. 447607Family a.118.3.1: Sec7 domain [48426] (4 proteins)
  6. 447618Protein Exchange factor ARNO [48427] (1 species)
  7. 447619Species Human (Homo sapiens) [TaxId:9606] [48428] (5 PDB entries)
  8. 447620Domain d1r8se_: 1r8s E: [97248]
    Other proteins in same PDB: d1r8sa_

Details for d1r8se_

PDB Entry: 1r8s (more details), 1.46 Å

PDB Description: arf1[delta1-17]-gdp in complex with a sec7 domain carrying the mutation of the catalytic glutamate to lysine

SCOP Domain Sequences for d1r8se_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8se_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens)}
nrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylgereel
nlavlhafvdlheftdlnlvqalrqflwsfrlpgkaqkidrmmeafaqryclcnpgvfqs
tdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlydsirne
pfkiped

SCOP Domain Coordinates for d1r8se_:

Click to download the PDB-style file with coordinates for d1r8se_.
(The format of our PDB-style files is described here.)

Timeline for d1r8se_: