Lineage for d1r8se_ (1r8s E:)
- Root: SCOP 1.67
Class a: All alpha proteins [46456] (202 folds) 
Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.3: Sec7 domain [48425] (1 family) 
Family a.118.3.1: Sec7 domain [48426] (4 proteins) Protein Exchange factor ARNO [48427] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48428] (5 PDB entries) 
Domain d1r8se_: 1r8s E: [97248]
Other proteins in same PDB: d1r8sa_
complexed with bme, fmt, gdp, so3, so4; mutant
Details for d1r8se_
PDB Entry: 1r8s (more details), 1.46 Å
PDB Description: arf1[delta1-17]-gdp in complex with a sec7 domain carrying the mutation of the catalytic glutamate to lysine
SCOP Domain Sequences for d1r8se_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8se_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens)}
nrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylgereel
nlavlhafvdlheftdlnlvqalrqflwsfrlpgkaqkidrmmeafaqryclcnpgvfqs
tdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlydsirne
pfkiped
SCOP Domain Coordinates for d1r8se_:
Click to download the PDB-style file with coordinates for d1r8se_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r8se_:
- d1r8se_ is new in SCOP 1.67
- d1r8se_ appears in SCOP 1.69
- d1r8se_ appears in the current release, SCOPe 2.08
View in 3D
