Lineage for d1r8sa_ (1r8s A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124193Protein ADP-ribosylation factor [52614] (16 species)
  7. 2124203Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries)
    Uniprot P32889
  8. 2124204Domain d1r8sa_: 1r8s A: [97247]
    Other proteins in same PDB: d1r8se_
    complexed with a sec7 domain
    complexed with bme, fmt, gdp, so3, so4; mutant

Details for d1r8sa_

PDB Entry: 1r8s (more details), 1.46 Å

PDB Description: arf1[delta1-17]-gdp in complex with a sec7 domain carrying the mutation of the catalytic glutamate to lysine
PDB Compounds: (A:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d1r8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnql

SCOPe Domain Coordinates for d1r8sa_:

Click to download the PDB-style file with coordinates for d1r8sa_.
(The format of our PDB-style files is described here.)

Timeline for d1r8sa_: