SCOPe 2.04: Domain d1r8sa_: 1r8s A:

Lineage for d1r8sa_ (1r8s A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (12 PDB entries)
   Uniprot P32889

8. Domain d1r8sa_: 1r8s A: [97247]
   Other proteins in same PDB: d1r8se_
   complexed with a sec7 domain
   complexed with bme, fmt, gdp, so3, so4; mutant

Details for d1r8sa_

PDB Entry: 1r8s, 1.46 Å

PDB Description: arf1[delta1-17]-gdp in complex with a sec7 domain carrying the mutation of the catalytic glutamate to lysine

PDB Compounds: (A:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d1r8sa_:

Sequence; same for both SEQRES and ATOM records:

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnql

Timeline for d1r8sa_:

• d1r8sa_ first appeared in SCOP 1.67
  
• d1r8sa_ appears in SCOPe 2.03
  
• d1r8sa_ appears in SCOPe 2.05
  
• d1r8sa_ appears in the current release, SCOPe 2.08