Lineage for d1r8qe_ (1r8q E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726245Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2726246Family a.118.3.1: Sec7 domain [48426] (6 proteins)
    Pfam PF01369
  6. 2726262Protein Exchange factor ARNO [48427] (1 species)
  7. 2726263Species Human (Homo sapiens) [TaxId:9606] [48428] (6 PDB entries)
  8. 2726268Domain d1r8qe_: 1r8q E: [97245]
    Other proteins in same PDB: d1r8qa_, d1r8qb_
    complexed with afb, g3d, mg, zn

Details for d1r8qe_

PDB Entry: 1r8q (more details), 1.86 Å

PDB Description: full-length arf1-gdp-mg in complex with brefeldin a and a sec7 domain
PDB Compounds: (E:) arno

SCOPe Domain Sequences for d1r8qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8qe_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens) [TaxId: 9606]}
sktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdyl
gereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcn
pgvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnly
dsirnepfkip

SCOPe Domain Coordinates for d1r8qe_:

Click to download the PDB-style file with coordinates for d1r8qe_.
(The format of our PDB-style files is described here.)

Timeline for d1r8qe_: