Lineage for d1r8ia_ (1r8i A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986263Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1986580Superfamily a.8.7: Typo IV secretion system protein TraC [101082] (1 family) (S)
    automatically mapped to Pfam PF07996
  5. 1986581Family a.8.7.1: Typo IV secretion system protein TraC [101083] (1 protein)
  6. 1986582Protein Typo IV secretion system protein TraC [101084] (1 species)
  7. 1986583Species Escherichia coli [TaxId:562] [101085] (1 PDB entry)
  8. 1986584Domain d1r8ia_: 1r8i A: [97239]

Details for d1r8ia_

PDB Entry: 1r8i (more details), 3 Å

PDB Description: Crystal structure of TraC
PDB Compounds: (A:) TraC

SCOPe Domain Sequences for d1r8ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ia_ a.8.7.1 (A:) Typo IV secretion system protein TraC {Escherichia coli [TaxId: 562]}
telikqgeqleqmaqqleqlksqletqknmyesmakttnlgdllgtstntlannlpdnwk
evysdamnssssvtpsvnsmmgqfnaevddmtpseaiaymnkklaekgaydrvmaekayn
nqmqelsdmqalteqikstpdlksiadlqariqtsqgaiqgeqaklnlmnmlqqsqdkll
raqkdra

SCOPe Domain Coordinates for d1r8ia_:

Click to download the PDB-style file with coordinates for d1r8ia_.
(The format of our PDB-style files is described here.)

Timeline for d1r8ia_: