Class a: All alpha proteins [46456] (289 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.7: Typo IV secretion system protein TraC [101082] (1 family) automatically mapped to Pfam PF07996 |
Family a.8.7.1: Typo IV secretion system protein TraC [101083] (1 protein) |
Protein Typo IV secretion system protein TraC [101084] (1 species) |
Species Escherichia coli [TaxId:562] [101085] (1 PDB entry) |
Domain d1r8ia_: 1r8i A: [97239] |
PDB Entry: 1r8i (more details), 3 Å
SCOPe Domain Sequences for d1r8ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8ia_ a.8.7.1 (A:) Typo IV secretion system protein TraC {Escherichia coli [TaxId: 562]} telikqgeqleqmaqqleqlksqletqknmyesmakttnlgdllgtstntlannlpdnwk evysdamnssssvtpsvnsmmgqfnaevddmtpseaiaymnkklaekgaydrvmaekayn nqmqelsdmqalteqikstpdlksiadlqariqtsqgaiqgeqaklnlmnmlqqsqdkll raqkdra
Timeline for d1r8ia_: