SCOP 1.67: Domain d1r8hc_: 1r8h C:

Lineage for d1r8hc_ (1r8h C:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 6a [TaxId:37122] [102990] (1 PDB entry)

8. Domain d1r8hc_: 1r8h C: [97235]

Details for d1r8hc_

PDB Entry: 1r8h, 1.9 Å

PDB Description: Comparison of the structure and DNA binding properties of the E2 proteins from an oncogenic and a non-oncogenic human papillomavirus

SCOP Domain Sequences for d1r8hc_:

Sequence, based on SEQRES records:

>d1r8hc_ d.58.8.1 (C:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a}
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll

Sequence, based on observed residues (ATOM records):

>d1r8hc_ d.58.8.1 (C:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a}
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkhaivtvtyhseeqrqq
flnvvkipptirhklgfmsmhll

Timeline for d1r8hc_:

• d1r8hc_ is new in SCOP 1.67
  
• d1r8hc_ appears in SCOP 1.69
  
• d1r8hc_ appears in the current release, SCOPe 2.08