Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) |
Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (1 protein) decorated fold with a large insertion |
Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species) |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102997] (17 PDB entries) |
Domain d1r8ca3: 1r8c A:258-437 [97232] Other proteins in same PDB: d1r8ca1, d1r8ca2 complexed with mn, na, utp |
PDB Entry: 1r8c (more details), 1.9 Å
SCOP Domain Sequences for d1r8ca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8ca3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd
Timeline for d1r8ca3: