Lineage for d1r8ca3 (1r8c A:258-437)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725174Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 725187Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (1 protein)
    decorated fold with a large insertion
  6. 725188Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 725189Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102997] (17 PDB entries)
  8. 725191Domain d1r8ca3: 1r8c A:258-437 [97232]
    Other proteins in same PDB: d1r8ca1, d1r8ca2
    complexed with mn, na, utp

Details for d1r8ca3

PDB Entry: 1r8c (more details), 1.9 Å

PDB Description: Crystal Structures of an Archaeal Class I CCA-Adding Enzyme and Its Nucleotide
PDB Compounds: (A:) tRNA nucleotidyltransferase

SCOP Domain Sequences for d1r8ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ca3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOP Domain Coordinates for d1r8ca3:

Click to download the PDB-style file with coordinates for d1r8ca3.
(The format of our PDB-style files is described here.)

Timeline for d1r8ca3: