Lineage for d1r8ca2 (1r8c A:1-142)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239280Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2239281Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2239625Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
    similar overall structure to poly(A) polymerase, PAP
  6. 2239626Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)
  7. 2239627Species Archaeoglobus fulgidus [TaxId:2234] [102942] (26 PDB entries)
    Uniprot O28126
  8. 2239629Domain d1r8ca2: 1r8c A:1-142 [97231]
    Other proteins in same PDB: d1r8ca1, d1r8ca3
    complexed with mn, na, utp

Details for d1r8ca2

PDB Entry: 1r8c (more details), 1.9 Å

PDB Description: Crystal Structures of an Archaeal Class I CCA-Adding Enzyme and Its Nucleotide
PDB Compounds: (A:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1r8ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ca2 d.218.1.7 (A:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
kniksavdrtpfhhkwlegrik

SCOPe Domain Coordinates for d1r8ca2:

Click to download the PDB-style file with coordinates for d1r8ca2.
(The format of our PDB-style files is described here.)

Timeline for d1r8ca2: