Lineage for d1r8ba3 (1r8b A:258-437)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953807Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2953823Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins)
    decorated fold with a large insertion
  6. 2953824Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 2953825Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries)
    Uniprot O28126
  8. 2953829Domain d1r8ba3: 1r8b A:258-437 [97229]
    Other proteins in same PDB: d1r8ba1, d1r8ba2
    complexed with atp, cl, mg, mn, na

Details for d1r8ba3

PDB Entry: 1r8b (more details), 2 Å

PDB Description: Crystal Structures of an Archaeal Class I CCA-Adding Enzyme and Its Nucleotide
PDB Compounds: (A:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1r8ba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ba3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOPe Domain Coordinates for d1r8ba3:

Click to download the PDB-style file with coordinates for d1r8ba3.
(The format of our PDB-style files is described here.)

Timeline for d1r8ba3: