Lineage for d1r8ba2 (1r8b A:1-142)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422922Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 422923Superfamily d.218.1: Nucleotidyltransferase [81301] (8 families) (S)
  5. 423094Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
    similar overall structure to poly(A) polymerase, PAP
  6. 423095Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)
  7. 423096Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102942] (7 PDB entries)
  8. 423100Domain d1r8ba2: 1r8b A:1-142 [97228]
    Other proteins in same PDB: d1r8ba1, d1r8ba3
    complexed with atp, cl, mg, mn, na

Details for d1r8ba2

PDB Entry: 1r8b (more details), 2 Å

PDB Description: Crystal Structures of an Archaeal Class I CCA-Adding Enzyme and Its Nucleotide

SCOP Domain Sequences for d1r8ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ba2 d.218.1.7 (A:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus}
mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
kniksavdrtpfhhkwlegrik

SCOP Domain Coordinates for d1r8ba2:

Click to download the PDB-style file with coordinates for d1r8ba2.
(The format of our PDB-style files is described here.)

Timeline for d1r8ba2: