Lineage for d1r8ba1 (1r8b A:143-257)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545511Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 545512Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (3 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 545527Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)
  6. 545528Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)
  7. 545529Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101276] (10 PDB entries)
  8. 545533Domain d1r8ba1: 1r8b A:143-257 [97227]
    Other proteins in same PDB: d1r8ba2, d1r8ba3
    complexed with atp, cl, mg, mn, na

Details for d1r8ba1

PDB Entry: 1r8b (more details), 2 Å

PDB Description: Crystal Structures of an Archaeal Class I CCA-Adding Enzyme and Its Nucleotide

SCOP Domain Sequences for d1r8ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ba1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeon Archaeoglobus fulgidus}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

SCOP Domain Coordinates for d1r8ba1:

Click to download the PDB-style file with coordinates for d1r8ba1.
(The format of our PDB-style files is described here.)

Timeline for d1r8ba1: