Class a: All alpha proteins [46456] (290 folds) |
Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) this domain follows the catalytic nucleotidyltransferase domain |
Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein) automatically mapped to Pfam PF09249 |
Protein tRNA nucleotidyltransferase, second domain [101275] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [101276] (26 PDB entries) Uniprot O28126 |
Domain d1r8ba1: 1r8b A:143-257 [97227] Other proteins in same PDB: d1r8ba2, d1r8ba3 complexed with atp, cl, mg, mn, na |
PDB Entry: 1r8b (more details), 2 Å
SCOPe Domain Sequences for d1r8ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8ba1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeoglobus fulgidus [TaxId: 2234]} gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk
Timeline for d1r8ba1: