| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) ![]() |
| Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins) decorated fold with a large insertion |
| Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries) Uniprot O28126 |
| Domain d1r89a3: 1r89 A:258-437 [97223] Other proteins in same PDB: d1r89a1, d1r89a2 complexed with cl, ctp, mg, mn, na |
PDB Entry: 1r89 (more details), 1.8 Å
SCOPe Domain Sequences for d1r89a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r89a3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd
Timeline for d1r89a3: