| Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
| Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families) ![]() |
| Family f.13.1.1: Bacteriorhodopsin-like [81319] (5 proteins) |
| Protein Bacteriorhodopsin [56871] (2 species) a light-driven proton pump |
| Species Archaeon Halobacterium salinarum [TaxId:2242] [56873] (60 PDB entries) |
| Domain d1r84a_: 1r84 A: [97218] complexed with ret |
PDB Entry: 1r84 (more details)
SCOP Domain Sequences for d1r84a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r84a_ f.13.1.1 (A:) Bacteriorhodopsin {Archaeon Halobacterium salinarum [TaxId: 2242]}
qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge
Timeline for d1r84a_: