Lineage for d1r82a_ (1r82 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133477Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 protein domains)
    automatically mapped to Pfam PF03414
  6. 2133579Protein Glycosyltransferase B [75278] (1 species)
    involved in blood group antigen biosynthesis
  7. 2133580Species Human (Homo sapiens) [TaxId:9606] [75279] (13 PDB entries)
  8. 2133585Domain d1r82a_: 1r82 A: [97217]
    complexed with gdu, hg

Details for d1r82a_

PDB Entry: 1r82 (more details), 1.55 Å

PDB Description: Glycosyltransferase B in complex with 3-amino-acceptor analog inhibitor, and uridine diphosphate-galactose
PDB Compounds: (A:) Glycoprotein-fucosylgalactoside alpha-galactosyltransferase

SCOPe Domain Sequences for d1r82a_:

Sequence, based on SEQRES records: (download)

>d1r82a_ c.68.1.9 (A:) Glycosyltransferase B {Human (Homo sapiens) [TaxId: 9606]}
mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwq
dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssre
aftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhd
eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

Sequence, based on observed residues (ATOM records): (download)

>d1r82a_ c.68.1.9 (A:) Glycosyltransferase B {Human (Homo sapiens) [TaxId: 9606]}
mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevcerrfls
evdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegd
fyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspe
ylwdqqllgwpavlrklrftavp

SCOPe Domain Coordinates for d1r82a_:

Click to download the PDB-style file with coordinates for d1r82a_.
(The format of our PDB-style files is described here.)

Timeline for d1r82a_: