Lineage for d1r7sc_ (1r7s C:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854217Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 854218Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 854219Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 854262Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (12 PDB entries)
  8. 854273Domain d1r7sc_: 1r7s C: [97209]
    complexed with fes; mutant

Details for d1r7sc_

PDB Entry: 1r7s (more details), 1.91 Å

PDB Description: putidaredoxin (fe2s2 ferredoxin), c73g mutant
PDB Compounds: (C:) putidaredoxin

SCOP Domain Sequences for d1r7sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7sc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlegvtaelkpnsrlccqiimtpeldgivvdvpdrqw

SCOP Domain Coordinates for d1r7sc_:

Click to download the PDB-style file with coordinates for d1r7sc_.
(The format of our PDB-style files is described here.)

Timeline for d1r7sc_: