Lineage for d1r7ia1 (1r7i A:111-220)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412909Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 412910Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 412911Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 412949Species Pseudomonas mevalonii [TaxId:32044] [55039] (4 PDB entries)
  8. 412950Domain d1r7ia1: 1r7i A:111-220 [97198]
    Other proteins in same PDB: d1r7ia2, d1r7ib2

Details for d1r7ia1

PDB Entry: 1r7i (more details), 2.21 Å

PDB Description: HMG-CoA Reductase from P. mevalonii, native structure at 2.2 angstroms resolution.

SCOP Domain Sequences for d1r7ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7ia1 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

SCOP Domain Coordinates for d1r7ia1:

Click to download the PDB-style file with coordinates for d1r7ia1.
(The format of our PDB-style files is described here.)

Timeline for d1r7ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r7ia2