Lineage for d1r7ha_ (1r7h A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395824Family c.47.1.1: Thioltransferase [52834] (9 proteins)
  6. 395849Protein Glutaredoxin-like NRDH-redoxin [64052] (2 species)
  7. 395850Species Corynebacterium ammoniagenes [TaxId:1697] [102432] (1 PDB entry)
  8. 395851Domain d1r7ha_: 1r7h A: [97196]

Details for d1r7ha_

PDB Entry: 1r7h (more details), 2.69 Å

PDB Description: NrdH-redoxin of Corynebacterium ammoniagenes forms a domain-swapped dimer

SCOP Domain Sequences for d1r7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes}
msitlytkpacvqctatkkaldraglayntvdislddeardyvmalgyvqapvvevdgeh
wsgfrperikqlqa

SCOP Domain Coordinates for d1r7ha_:

Click to download the PDB-style file with coordinates for d1r7ha_.
(The format of our PDB-style files is described here.)

Timeline for d1r7ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r7hb_