Lineage for d1r7ab1 (1r7a B:435-504)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380059Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 380060Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 380061Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 380333Protein Sucrose phosphorylase [101920] (1 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 380334Species Bifidobacterium adolescentis [TaxId:1680] [101921] (1 PDB entry)
  8. 380336Domain d1r7ab1: 1r7a B:435-504 [97194]
    Other proteins in same PDB: d1r7aa2, d1r7ab2
    complexed with trs

Details for d1r7ab1

PDB Entry: 1r7a (more details), 1.77 Å

PDB Description: Sucrose Phosphorylase from Bifidobacterium adolescentis

SCOP Domain Sequences for d1r7ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7ab1 b.71.1.1 (B:435-504) Sucrose phosphorylase {Bifidobacterium adolescentis}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

SCOP Domain Coordinates for d1r7ab1:

Click to download the PDB-style file with coordinates for d1r7ab1.
(The format of our PDB-style files is described here.)

Timeline for d1r7ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r7ab2