Class g: Small proteins [56992] (94 folds) |
Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) |
Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins) Pfam PF00130 |
Protein Diacylglycerol kinase delta [103628] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [103629] (1 PDB entry) |
Domain d1r79a1: 1r79 A:8-78 [97191] Other proteins in same PDB: d1r79a2, d1r79a3 C1 domain complexed with zn |
PDB Entry: 1r79 (more details)
SCOPe Domain Sequences for d1r79a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r79a1 g.49.1.1 (A:8-78) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} ttlasigkdiiedadgiamphqwlegnlpvsakctvcdktcgsvlrlqdwrclwckamvh tsckeslltkc
Timeline for d1r79a1: