Lineage for d1r79a1 (1r79 A:8-78)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264294Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2264295Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2264296Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 2264300Protein Diacylglycerol kinase delta [103628] (1 species)
  7. 2264301Species Human (Homo sapiens) [TaxId:9606] [103629] (1 PDB entry)
  8. 2264302Domain d1r79a1: 1r79 A:8-78 [97191]
    Other proteins in same PDB: d1r79a2, d1r79a3
    C1 domain
    complexed with zn

Details for d1r79a1

PDB Entry: 1r79 (more details)

PDB Description: solution structure of the c1 domain of the human diacylglycerol kinase delta
PDB Compounds: (A:) Diacylglycerol kinase, delta

SCOPe Domain Sequences for d1r79a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r79a1 g.49.1.1 (A:8-78) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]}
ttlasigkdiiedadgiamphqwlegnlpvsakctvcdktcgsvlrlqdwrclwckamvh
tsckeslltkc

SCOPe Domain Coordinates for d1r79a1:

Click to download the PDB-style file with coordinates for d1r79a1.
(The format of our PDB-style files is described here.)

Timeline for d1r79a1: