SCOP 1.67: Domain d1r79a_: 1r79 A:

Lineage for d1r79a_ (1r79 A:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (2 families)

5. Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (5 proteins)

6. Protein Diacylglycerol kinase delta [103628] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103629] (1 PDB entry)

8. Domain d1r79a_: 1r79 A: [97191]
   C1 domain
   complexed with zn

Details for d1r79a_

PDB Entry: 1r79

PDB Description: solution structure of the c1 domain of the human diacylglycerol kinase delta

SCOP Domain Sequences for d1r79a_:

Sequence; same for both SEQRES and ATOM records:

>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens)}
gssgssgttlasigkdiiedadgiamphqwlegnlpvsakctvcdktcgsvlrlqdwrcl
wckamvhtsckeslltkcsgpssg

Timeline for d1r79a_:

• d1r79a_ is new in SCOP 1.67
  
• d1r79a_ appears in SCOP 1.69
  
• d1r79a_ appears in the current release, SCOPe 2.08, called d1r79a1