Lineage for d1r75a_ (1r75 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077556Fold b.134: Smp-1-like [101600] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key/jelly-roll
  4. 2077557Superfamily b.134.1: Smp-1-like [101601] (1 family) (S)
  5. 2077558Family b.134.1.1: Smp-1-like [101602] (2 protein domains)
  6. 2077562Protein Unnamed hypothetical protein [101603] (1 species)
    similar to calpain-like protein fragment from Trypanosoma brucei and the L2230.07 gene product from Leishmania major
  7. 2077563Species Leishmania major [TaxId:5664] [101604] (1 PDB entry)
  8. 2077564Domain d1r75a_: 1r75 A: [97189]
    structural genomics
    complexed with gol

Details for d1r75a_

PDB Entry: 1r75 (more details), 1.86 Å

PDB Description: Leishmania major hypothetical protein
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1r75a_:

Sequence, based on SEQRES records: (download)

>d1r75a_ b.134.1.1 (A:) Unnamed hypothetical protein {Leishmania major [TaxId: 5664]}
vtfkngkptvkgtktypmfsnilyriadtearrwafyndskeliihvavlfdydsqivpl
gdttafriddpdegneddfgkylcevdvrpletqmfvegsvtgwrvdtleartaedergy
r

Sequence, based on observed residues (ATOM records): (download)

>d1r75a_ b.134.1.1 (A:) Unnamed hypothetical protein {Leishmania major [TaxId: 5664]}
vtfkngkptvkgtktypmfsnilyriadtearrwafyndskeliihvavlfdydsqivpl
gdttafrigkylcevdvrpletqmfvegsvtgwrvdtleartaedergyr

SCOPe Domain Coordinates for d1r75a_:

Click to download the PDB-style file with coordinates for d1r75a_.
(The format of our PDB-style files is described here.)

Timeline for d1r75a_: