SCOPe 2.07: Domain d1r6zz2: 1r6z Z:2-371

Lineage for d1r6zz2 (1r6z Z:2-371)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (69 PDB entries)
   Uniprot P02928

8. Domain d1r6zz2: 1r6z Z:2-371 [97174]
   Other proteins in same PDB: d1r6za1, d1r6zp1, d1r6zz1
   chimera with a PAZ domain
   complexed with mal, ni

Details for d1r6zz2

PDB Entry: 1r6z, 2.8 Å

PDB Description: the crystal structure of the argonaute2 paz domain (as a mbp fusion)

PDB Compounds: (Z:) Chimera of Maltose-binding periplasmic protein and Argonaute 2

SCOPe Domain Sequences for d1r6zz2:

Sequence; same for both SEQRES and ATOM records:

>d1r6zz2 c.94.1.1 (Z:2-371) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
eegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifw
ahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdll
pnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvg
vdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvny
gvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgav
alksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealk
daqtnaaaef

Timeline for d1r6zz2:

• d1r6zz2 first appeared in SCOP 1.67
  
• d1r6zz2 appears in SCOPe 2.06
  
• d1r6zz2 appears in the current release, SCOPe 2.08