Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.14: PAZ domain [101690] (1 family) |
Family b.34.14.1: PAZ domain [101691] (6 proteins) |
Protein Argonaute 2 [101692] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries) Uniprot Q9VUQ5 602-717 ! Uniprot Q9VUQ5 602-720 |
Domain d1r6zz1: 1r6z Z:591-719 [97173] Other proteins in same PDB: d1r6za2, d1r6zp2, d1r6zz2 fused with MBP complexed with mal, ni |
PDB Entry: 1r6z (more details), 2.8 Å
SCOPe Domain Sequences for d1r6zz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r6zz1 b.34.14.1 (Z:591-719) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} vdishksfpismpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsa prvyrvnglsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpi elcsieegq
Timeline for d1r6zz1:
View in 3D Domains from other chains: (mouse over for more information) d1r6za1, d1r6za2, d1r6zp1, d1r6zp2 |