Lineage for d1r6zp1 (1r6z P:591-717)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785323Superfamily b.34.14: PAZ domain [101690] (1 family) (S)
  5. 1785324Family b.34.14.1: PAZ domain [101691] (6 proteins)
  6. 1785328Protein Argonaute 2 [101692] (1 species)
  7. 1785329Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries)
    Uniprot Q9VUQ5 602-717 ! Uniprot Q9VUQ5 602-720
  8. 1785334Domain d1r6zp1: 1r6z P:591-717 [97171]
    Other proteins in same PDB: d1r6za2, d1r6zp2, d1r6zz2
    fused with MBP
    complexed with mal, ni

Details for d1r6zp1

PDB Entry: 1r6z (more details), 2.8 Å

PDB Description: the crystal structure of the argonaute2 paz domain (as a mbp fusion)
PDB Compounds: (P:) Chimera of Maltose-binding periplasmic protein and Argonaute 2

SCOPe Domain Sequences for d1r6zp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6zp1 b.34.14.1 (P:591-717) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vdishksfpismpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsa
prvyrvnglsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpi
elcsiee

SCOPe Domain Coordinates for d1r6zp1:

Click to download the PDB-style file with coordinates for d1r6zp1.
(The format of our PDB-style files is described here.)

Timeline for d1r6zp1: