SCOPe 2.08: Domain d1r6zp1: 1r6z P:591-717

Lineage for d1r6zp1 (1r6z P:591-717)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.14: PAZ domain [101690] (2 families)

5. Family b.34.14.1: PAZ domain [101691] (6 proteins)

6. Protein Argonaute 2 [101692] (2 species)
   Pfam PF16486; Pfam PF08699; Pfam PF16488

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries)
   Uniprot Q9VUQ5 602-717 ! Uniprot Q9VUQ5 602-720

8. Domain d1r6zp1: 1r6z P:591-717 [97171]
   Other proteins in same PDB: d1r6za2, d1r6zp2, d1r6zz2
   fused with MBP
   complexed with ni

Details for d1r6zp1

PDB Entry: 1r6z, 2.8 Å

PDB Description: the crystal structure of the argonaute2 paz domain (as a mbp fusion)

PDB Compounds: (P:) Chimera of Maltose-binding periplasmic protein and Argonaute 2

SCOPe Domain Sequences for d1r6zp1:

Sequence; same for both SEQRES and ATOM records:

>d1r6zp1 b.34.14.1 (P:591-717) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vdishksfpismpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsa
prvyrvnglsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpi
elcsiee

Timeline for d1r6zp1:

• d1r6zp1 first appeared in SCOP 1.67
  
• d1r6zp1 appears in SCOPe 2.07