Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein D-maltodextrin-binding protein, MBP [53862] (5 species) contains a few additional helices in the C-terminal extension; homologous to thiaminase I |
Species Escherichia coli [TaxId:562] [53863] (69 PDB entries) Uniprot P02928 |
Domain d1r6za2: 1r6z A:1-371 [97170] Other proteins in same PDB: d1r6za1, d1r6zp1, d1r6zz1 chimera with a PAZ domain complexed with ni has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1r6z (more details), 2.8 Å
SCOPe Domain Sequences for d1r6za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r6za2 c.94.1.1 (A:1-371) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} ieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiif wahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdl lpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdv gvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvn ygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplga valksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdeal kdaqtnaaaef
Timeline for d1r6za2:
View in 3D Domains from other chains: (mouse over for more information) d1r6zp1, d1r6zp2, d1r6zz1, d1r6zz2 |