SCOPe 2.04: Domain d1r6za1: 1r6z A:591-716

Lineage for d1r6za1 (1r6z A:591-716)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.14: PAZ domain [101690] (1 family)

5. Family b.34.14.1: PAZ domain [101691] (6 proteins)

6. Protein Argonaute 2 [101692] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries)
   Uniprot Q9VUQ5 602-717 ! Uniprot Q9VUQ5 602-720

8. Domain d1r6za1: 1r6z A:591-716 [97169]
   Other proteins in same PDB: d1r6za2, d1r6zp2, d1r6zz2
   fused with MBP
   complexed with mal, ni

Details for d1r6za1

PDB Entry: 1r6z, 2.8 Å

PDB Description: the crystal structure of the argonaute2 paz domain (as a mbp fusion)

PDB Compounds: (A:) Chimera of Maltose-binding periplasmic protein and Argonaute 2

SCOPe Domain Sequences for d1r6za1:

Sequence; same for both SEQRES and ATOM records:

>d1r6za1 b.34.14.1 (A:591-716) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vdishksfpismpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsa
prvyrvnglsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpi
elcsie

Timeline for d1r6za1:

• d1r6za1 first appeared in SCOP 1.67
  
• d1r6za1 appears in SCOPe 2.03
  
• d1r6za1 appears in SCOPe 2.05
  
• d1r6za1 appears in the current release, SCOPe 2.08