Lineage for d1r6xa2 (1r6x A:169-387)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482379Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 482667Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 482668Protein ATP sulfurylase central domain [63980] (4 species)
  7. 482669Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (8 PDB entries)
  8. 482683Domain d1r6xa2: 1r6x A:169-387 [97168]
    Other proteins in same PDB: d1r6xa1
    truncated form lacking the C-terminal APC kinase-like domain

Details for d1r6xa2

PDB Entry: 1r6x (more details), 1.4 Å

PDB Description: The Crystal Structure of a Truncated Form of Yeast ATP Sulfurylase, Lacking the C-Terminal APS Kinase-like Domain, in complex with Sulfate

SCOP Domain Sequences for d1r6xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6xa2 c.26.1.5 (A:169-387) ATP sulfurylase central domain {Baker's yeast (Saccharomyces cerevisiae)}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilres

SCOP Domain Coordinates for d1r6xa2:

Click to download the PDB-style file with coordinates for d1r6xa2.
(The format of our PDB-style files is described here.)

Timeline for d1r6xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r6xa1