Lineage for d1r6xa2 (1r6x A:169-387)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860766Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
    automatically mapped to Pfam PF01747
  6. 2860767Protein ATP sulfurylase catalytic domain [63980] (5 species)
  7. 2860768Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (8 PDB entries)
  8. 2860782Domain d1r6xa2: 1r6x A:169-387 [97168]
    Other proteins in same PDB: d1r6xa1
    truncated form lacking the C-terminal APC kinase-like domain
    complexed with co, so4

Details for d1r6xa2

PDB Entry: 1r6x (more details), 1.4 Å

PDB Description: The Crystal Structure of a Truncated Form of Yeast ATP Sulfurylase, Lacking the C-Terminal APS Kinase-like Domain, in complex with Sulfate
PDB Compounds: (A:) ATP:sulfate adenylyltransferase

SCOPe Domain Sequences for d1r6xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6xa2 c.26.1.5 (A:169-387) ATP sulfurylase catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilres

SCOPe Domain Coordinates for d1r6xa2:

Click to download the PDB-style file with coordinates for d1r6xa2.
(The format of our PDB-style files is described here.)

Timeline for d1r6xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r6xa1