Lineage for d1r6wa2 (1r6w A:1-99)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554740Protein O-succinylbenzoate synthase [54834] (1 species)
  7. 2554741Species Escherichia coli [TaxId:562] [54835] (4 PDB entries)
  8. 2554742Domain d1r6wa2: 1r6w A:1-99 [97166]
    Other proteins in same PDB: d1r6wa1, d1r6wa3
    complexed with 164, mg; mutant

Details for d1r6wa2

PDB Entry: 1r6w (more details), 1.62 Å

PDB Description: crystal structure of the k133r mutant of o-succinylbenzoate synthase (osbs) from escherichia coli. complex with shchc
PDB Compounds: (A:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d1r6wa2:

Sequence, based on SEQRES records: (download)

>d1r6wa2 d.54.1.1 (A:1-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
mrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetweeaq
svllawvnnwlagdcelpqmpsvafgvscalaeltdtlp

Sequence, based on observed residues (ATOM records): (download)

>d1r6wa2 d.54.1.1 (A:1-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
mrsaqvyrwqipmdagvvldrrlktrdglyvclregeregwgeisplpgfsqetweeaqs
vllawvnnwlagdcelpqmpsvafgvscalaeltdtlp

SCOPe Domain Coordinates for d1r6wa2:

Click to download the PDB-style file with coordinates for d1r6wa2.
(The format of our PDB-style files is described here.)

Timeline for d1r6wa2: