Lineage for d1r6ua_ (1r6u A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482379Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 482380Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 482456Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species)
    overall structure is similar to TyrRS
  7. 482481Species Human (Homo sapiens) [TaxId:9606] [102256] (4 PDB entries)
  8. 482484Domain d1r6ua_: 1r6u A: [97163]

Details for d1r6ua_

PDB Entry: 1r6u (more details), 2 Å

PDB Description: crystal structure of an active fragment of human tryptophanyl-trna synthetase with cytokine activity

SCOP Domain Sequences for d1r6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6ua_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens)}
edfvdpwtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshr
dmnqvldayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddeky
lwkdltldqaygdavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfn
qvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtr
dvaprigypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggr
dtieehrqfggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpl
iaehqarrkevtdeivkefmtprklsfd

SCOP Domain Coordinates for d1r6ua_:

Click to download the PDB-style file with coordinates for d1r6ua_.
(The format of our PDB-style files is described here.)

Timeline for d1r6ua_: