![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily) core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices |
![]() | Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families) ![]() automatically mapped to Pfam PF01003 |
![]() | Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein) |
![]() | Protein Flavivirus capsid protein C [101259] (3 species) |
![]() | Species Dengue virus type 2 [TaxId:11060] [101260] (1 PDB entry) |
![]() | Domain d1r6rb_: 1r6r B: [97159] |
PDB Entry: 1r6r (more details)
SCOPe Domain Sequences for d1r6rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r6rb_ a.190.1.1 (B:) Flavivirus capsid protein C {Dengue virus type 2 [TaxId: 11060]} nrvstvqqltkrfslgmlqgrgplklfmalvaflrfltipptagilkrwgtikkskainv lrgfrkeigrmlnilnrrrr
Timeline for d1r6rb_: