SCOPe 2.07: Domain d1r6rb_: 1r6r B:

Lineage for d1r6rb_ (1r6r B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
   core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices

4. Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families)
   automatically mapped to Pfam PF01003

5. Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)

6. Protein Flavivirus capsid protein C [101259] (3 species)

7. Species Dengue virus type 2 [TaxId:11060] [101260] (1 PDB entry)

8. Domain d1r6rb_: 1r6r B: [97159]

Details for d1r6rb_

PDB Entry: 1r6r

PDB Description: solution structure of dengue virus capsid protein reveals a new fold

PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d1r6rb_:

Sequence; same for both SEQRES and ATOM records:

>d1r6rb_ a.190.1.1 (B:) Flavivirus capsid protein C {Dengue virus type 2 [TaxId: 11060]}
nrvstvqqltkrfslgmlqgrgplklfmalvaflrfltipptagilkrwgtikkskainv
lrgfrkeigrmlnilnrrrr

Timeline for d1r6rb_:

• d1r6rb_ first appeared in SCOP 1.67
  
• d1r6rb_ appears in SCOPe 2.06
  
• d1r6rb_ appears in the current release, SCOPe 2.08