Lineage for d1r6rb_ (1r6r B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362443Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. 362444Superfamily a.190.1: Flavivirus capsid protein C [101257] (1 family) (S)
  5. 362445Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)
  6. 362446Protein Flavivirus capsid protein C [101259] (1 species)
  7. 362447Species Dengue virus type 2 [TaxId:12637] [101260] (1 PDB entry)
  8. 362449Domain d1r6rb_: 1r6r B: [97159]

Details for d1r6rb_

PDB Entry: 1r6r (more details)

PDB Description: Solution Structure of Dengue Virus Capsid Protein Reveals a New Fold

SCOP Domain Sequences for d1r6rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6rb_ a.190.1.1 (B:) Flavivirus capsid protein C {Dengue virus type 2}
nrvstvqqltkrfslgmlqgrgplklfmalvaflrfltipptagilkrwgtikkskainv
lrgfrkeigrmlnilnrrrr

SCOP Domain Coordinates for d1r6rb_:

Click to download the PDB-style file with coordinates for d1r6rb_.
(The format of our PDB-style files is described here.)

Timeline for d1r6rb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r6ra_