SCOP 1.67: Domain d1r6ra_: 1r6r A:

Lineage for d1r6ra_ (1r6r A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
   core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices

4. Superfamily a.190.1: Flavivirus capsid protein C [101257] (1 family)

5. Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)

6. Protein Flavivirus capsid protein C [101259] (1 species)

7. Species Dengue virus type 2 [TaxId:12637] [101260] (1 PDB entry)

8. Domain d1r6ra_: 1r6r A: [97158]

Details for d1r6ra_

PDB Entry: 1r6r

PDB Description: solution structure of dengue virus capsid protein reveals a new fold

SCOP Domain Sequences for d1r6ra_:

Sequence; same for both SEQRES and ATOM records:

>d1r6ra_ a.190.1.1 (A:) Flavivirus capsid protein C {Dengue virus type 2}
nrvstvqqltkrfslgmlqgrgplklfmalvaflrfltipptagilkrwgtikkskainv
lrgfrkeigrmlnilnrrrr

Timeline for d1r6ra_:

• d1r6ra_ is new in SCOP 1.67
  
• d1r6ra_ appears in SCOP 1.69
  
• d1r6ra_ appears in the current release, SCOPe 2.08