Lineage for d1r6ra_ (1r6r A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341770Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. 2341771Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families) (S)
    automatically mapped to Pfam PF01003
  5. 2341772Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)
  6. 2341773Protein Flavivirus capsid protein C [101259] (2 species)
  7. 2341774Species Dengue virus type 2 [TaxId:11060] [101260] (1 PDB entry)
  8. 2341775Domain d1r6ra_: 1r6r A: [97158]

Details for d1r6ra_

PDB Entry: 1r6r (more details)

PDB Description: Solution Structure of Dengue Virus Capsid Protein Reveals a New Fold
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d1r6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6ra_ a.190.1.1 (A:) Flavivirus capsid protein C {Dengue virus type 2 [TaxId: 11060]}
nrvstvqqltkrfslgmlqgrgplklfmalvaflrfltipptagilkrwgtikkskainv
lrgfrkeigrmlnilnrrrr

SCOPe Domain Coordinates for d1r6ra_:

Click to download the PDB-style file with coordinates for d1r6ra_.
(The format of our PDB-style files is described here.)

Timeline for d1r6ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r6rb_