Lineage for d1r6na1 (1r6n A:2-196)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407758Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily)
    complex fold made of bifurcated and coiled beta-sheets
  4. 2407759Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (2 families) (S)
    automatically mapped to Pfam PF00508
  5. 2407760Family b.91.1.1: E2 regulatory, transactivation domain [51333] (1 protein)
  6. 2407761Protein E2 regulatory, transactivation domain [51334] (3 species)
  7. 2407762Species Human papillomavirus type 11 [TaxId:10580] [102015] (2 PDB entries)
  8. 2407763Domain d1r6na1: 1r6n A:2-196 [97157]
    Other proteins in same PDB: d1r6na2
    contains additional N-terminal (sub)domain; alpha-hairpin
    complexed with 434, alq, dms

Details for d1r6na1

PDB Entry: 1r6n (more details), 2.4 Å

PDB Description: hpv11 e2 tad complex crystal structure
PDB Compounds: (A:) hpv11 regulatory protein e2

SCOPe Domain Sequences for d1r6na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6na1 b.91.1.1 (A:2-196) E2 regulatory, transactivation domain {Human papillomavirus type 11 [TaxId: 10580]}
eaiakrldacqdqllelyeensidihkhimhwkcirlesvllhkakqmglshiglqvvpp
ltvsetkghnaiemqmhleslaktqygvepwtlqdtsyemwltppkrcfkkqgntvevkf
dgcednvmeyvvwthiylqdndswvkvtssvdakgiyytcgqfktyyvnfnkeaqkygst
nhwevcygstvicsp

SCOPe Domain Coordinates for d1r6na1:

Click to download the PDB-style file with coordinates for d1r6na1.
(The format of our PDB-style files is described here.)

Timeline for d1r6na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r6na2