SCOPe 2.08: Domain d1r6na1: 1r6n A:2-196

Lineage for d1r6na1 (1r6n A:2-196)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily)
   complex fold made of bifurcated and coiled beta-sheets

4. Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (2 families)
   automatically mapped to Pfam PF00508

5. Family b.91.1.1: E2 regulatory, transactivation domain [51333] (1 protein)

6. Protein E2 regulatory, transactivation domain [51334] (3 species)

7. Species Human papillomavirus type 11 [TaxId:10580] [102015] (2 PDB entries)

8. Domain d1r6na1: 1r6n A:2-196 [97157]
   Other proteins in same PDB: d1r6na2
   contains additional N-terminal (sub)domain; alpha-hairpin
   complexed with 434, alq, dms

Details for d1r6na1

PDB Entry: 1r6n, 2.4 Å

PDB Description: hpv11 e2 tad complex crystal structure

PDB Compounds: (A:) hpv11 regulatory protein e2

SCOPe Domain Sequences for d1r6na1:

Sequence; same for both SEQRES and ATOM records:

>d1r6na1 b.91.1.1 (A:2-196) E2 regulatory, transactivation domain {Human papillomavirus type 11 [TaxId: 10580]}
eaiakrldacqdqllelyeensidihkhimhwkcirlesvllhkakqmglshiglqvvpp
ltvsetkghnaiemqmhleslaktqygvepwtlqdtsyemwltppkrcfkkqgntvevkf
dgcednvmeyvvwthiylqdndswvkvtssvdakgiyytcgqfktyyvnfnkeaqkygst
nhwevcygstvicsp

Timeline for d1r6na1:

• d1r6na1 first appeared in SCOP 1.67, called d1r6na_
  
• d1r6na1 appears in SCOPe 2.07