Lineage for d1r6ma2 (1r6m A:152-239)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509047Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 509048Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 509049Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (2 proteins)
  6. 509056Protein Ribonuclease PH, domain 2 [103150] (3 species)
  7. 509076Species Pseudomonas aeruginosa [TaxId:287] [103152] (2 PDB entries)
  8. 509078Domain d1r6ma2: 1r6m A:152-239 [97156]
    Other proteins in same PDB: d1r6ma1

Details for d1r6ma2

PDB Entry: 1r6m (more details), 2 Å

PDB Description: Crystal Structure Of The tRNA Processing Enzyme Rnase pH From Pseudomonas Aeruginosa In Complex With Phosphate

SCOP Domain Sequences for d1r6ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6ma2 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudomonas aeruginosa}
kgnplkqmvaavsvgiyqgvpvldldyledsaaetdlnvvmtdaggfievqgtaegapfr
paelnamlelaqqgmqelfelqraalae

SCOP Domain Coordinates for d1r6ma2:

Click to download the PDB-style file with coordinates for d1r6ma2.
(The format of our PDB-style files is described here.)

Timeline for d1r6ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r6ma1