Lineage for d1r6ma2 (1r6m A:152-239)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. Protein Ribonuclease PH, domain 2 [103150] (4 species)
  7. Species Pseudomonas aeruginosa [TaxId:287] [103152] (2 PDB entries)
  8. Domain d1r6ma2: 1r6m A:152-239 [97156]
    Other proteins in same PDB: d1r6ma1
    protein/RNA complex; complexed with po4

Details for d1r6ma2

PDB Entry: 1r6m (more details), 2 Å

PDB Description: Crystal Structure Of The tRNA Processing Enzyme Rnase pH From Pseudomonas Aeruginosa In Complex With Phosphate
PDB Compounds: (A:) Ribonuclease PH

SCOPe Domain Sequences for d1r6ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6ma2 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudomonas aeruginosa [TaxId: 287]}
kgnplkqmvaavsvgiyqgvpvldldyledsaaetdlnvvmtdaggfievqgtaegapfr
paelnamlelaqqgmqelfelqraalae

SCOPe Domain Coordinates for d1r6ma2 are not available.

Timeline for d1r6ma2:

Domains from same chain:
(mouse over for more information)
d1r6ma1