Lineage for d1r6ma1 (1r6m A:1-151)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499246Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 499247Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) (S)
  5. 499353Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (2 proteins)
  6. 499360Protein Ribonuclease PH, domain 1 [102758] (3 species)
  7. 499380Species Pseudomonas aeruginosa [TaxId:287] [102760] (2 PDB entries)
  8. 499382Domain d1r6ma1: 1r6m A:1-151 [97155]
    Other proteins in same PDB: d1r6ma2

Details for d1r6ma1

PDB Entry: 1r6m (more details), 2 Å

PDB Description: Crystal Structure Of The tRNA Processing Enzyme Rnase pH From Pseudomonas Aeruginosa In Complex With Phosphate

SCOP Domain Sequences for d1r6ma1:

Sequence, based on SEQRES records: (download)

>d1r6ma1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa}
mnrpsgraadqlrpiritrhytkhaegsvlvefgdtkvictvsaesgvprflkgqgqgwl
taeygmlprstgernqreasrgkqggrtleiqrligrslraaldlsklgentlyidcdvi
qadggtrtasitgatvalidalavlkkrgal

Sequence, based on observed residues (ATOM records): (download)

>d1r6ma1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa}
mnrpsgraadqlrpiritrhytkhaegsvlvefgdtkvictvsaesgvprflkqgwltae
ygmlprstgernqreasrgkqggrtleiqrligrslraaldlsklgentlyidcdviqad
ggtrtasitgatvalidalavlkkrgal

SCOP Domain Coordinates for d1r6ma1:

Click to download the PDB-style file with coordinates for d1r6ma1.
(The format of our PDB-style files is described here.)

Timeline for d1r6ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r6ma2